PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G17785.1
Common Namedl4925c, FCA0, MYB39
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 360aa    MW: 40023 Da    PI: 6.1042
Description myb domain protein 39
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G17785.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd++l  ++++ G g+W++ ++  g++R++k+c++rw +yl
      AT4G17785.1 15 KGPWLPEEDDKLTAYINENGYGNWRSLPKLAGLNRCGKSCRLRWMNYL 62
                     79********************************************97 PP

2Myb_DNA-binding50.16.2e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++  E+  +v+++++lG++ W++Ia +++ gRt++++k++w++++
      AT4G17785.1  68 RGKFSDGEESTIVRLHALLGNK-WSKIAGHLP-GRTDNEIKNYWNTHM 113
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9361062IPR017930Myb domain
SuperFamilySSF466892.67E-2812109IPR009057Homeodomain-like
SMARTSM007171.1E-111464IPR001005SANT/Myb domain
PfamPF002496.5E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-211669IPR009057Homeodomain-like
CDDcd001671.24E-91762No hitNo description
PROSITE profilePS5129425.81963117IPR017930Myb domain
SMARTSM007176.1E-1467115IPR001005SANT/Myb domain
PfamPF002493.4E-1468112IPR001005SANT/Myb domain
CDDcd001671.90E-1070113No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2570117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRSPCCDQD KGVKKGPWLP EEDDKLTAYI NENGYGNWRS LPKLAGLNRC GKSCRLRWMN  60
YLRPDIRRGK FSDGEESTIV RLHALLGNKW SKIAGHLPGR TDNEIKNYWN THMRKKLLQM  120
GIDPVTHEPR TNDLSPILDV SQMLAAAINN GQFGNNNLLN NNTALEDILK LQLIHKMLQI  180
ITPKAIPNIS SFKTNLLNPK PEPVVNSFNT NSVNPKPDPP AGLFINQSGI TPEAASDFIP  240
SYENVWDGFE DNQLPGLVTV SQESLNTAKP GTSTTTKVND HIRTGMMPCY YGDQLLETPS  300
TGSVSVSPET TSLNHPSTAQ HSSGSDFLED WEKFLDDETS DSCWKSFLDL TSPTSSPVPW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C7e-25151174105C-Myb DNA-Binding Domain
1mse_C7e-25151174105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible245381_at0.0
Expression AtlasAT4G17785-
AtGenExpressAT4G17785-
ATTED-IIAT4G17785-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB39).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00438DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G17785.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8GWP0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G17785
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1187280.0AK118728.1 Arabidopsis thaliana At4g17780 mRNA for putative MYB transcription factor, complete cds, clone: RAFL21-07-A19.
GenBankBT0056420.0BT005642.1 Arabidopsis thaliana clone U51012 putative MYB transcription factor (At4g17785) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567540.20.0transcription factor MYB39
SwissprotQ8GWP00.0MYB39_ARATH; Transcription factor MYB39
TrEMBLD7MDE60.0D7MDE6_ARALL; Putative uncharacterized protein
STRINGAT4G17785.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122431730
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Ma S,Gong Q,Bohnert HJ
    Dissecting salt stress pathways.
    J. Exp. Bot., 2006. 57(5): p. 1097-107
    [PMID:16510518]
  7. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  8. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]